POSA Home | FATCAT | Other Servers | Godzik Lab | School of Medicine, University of California, Reverside | Contact Us



The protein structure alignment is calculated on the following chains: 1fje:B; 1cvj:A; 1yty:A; 2adc:A; 3sde:A; 3smz:A; 2kxf:A; 2yh0:A;

 /1fjeB.pdb/ /B/ 1    6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   91   96   101  106  111  116  121  126  131  136  141  146  151  156  161  166  171  
GSHMVEGSESTTPFNLFIGNLNPNKSVAELKVAISELFAKNDLAVVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDALEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKG
 /1cvjA.pdb/ /A/ 11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   91   96   101  106  111  116  121  126  131  136  141  146  151  156  161  166  171  176  
ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKER
 /1ytyA.pdb/ /A/ 6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   91   96   101  106  111  116  121  126  131  136  141  146  151  156  161  166  171  176  181  186  
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYF
 /2adcA.pdb/ /A/ 324  329  334  339  344  349  354  359  364  369  374  379  384  389  394  399  404  409  414  419  424  429  434  439  444  449  454  459  464  469  474  479  484  489  494  499  504  509  514  519  524  529  
GRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI
 /3sdeA.pdb/ /A/ 66   71   76   81   86   91   96   101  106  111  116  121  126  131  136  141  146  151  156  161  166  171  176  181  186  191  196  201  206  211  216  221  226  231  236  241  246  251  256  261  266  271  276  281  286  291  296  301  306  311  316  
DIKSFLKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFGFIRLESRTLAEIAKAELDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREAKEKLEAEMEAARHEHQLMLM
 /3smzA.pdb/ /A/ 37   42   47   52   57   62   67   72   77   82   87   92   97   102  107  112  117  122  127  132  137  142  147  152  157  162  167  172  177  182  187  192  197  202  207  212  217  222  227  232  237  242  247  252  257  262  267  272  277  282  287  292  297  302  307  312  
HMLDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQAT
 /2kxfA.pdb/ /A/ 99   104  109  114  119  124  129  134  139  144  149  154  159  164  169  174  179  184  189  194  199  204  209  214  219  224  229  234  239  244  249  254  259  264  269  274  279  284  289  294  
GAMAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPAT
 /2yh0A.pdb/ /A/ 148  153  158  163  168  173  178  183  188  193  198  203  208  213  218  223  228  233  238  243  248  253  258  263  268  273  278  283  288  293  298  303  308  313  318  323  328  333  338  
ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
ColorPDBAligned Chain/Segments

residues at approximate pivot positions
common core regions

Download a UCSF Chimera script for publication ready visualization and multiple analysis tools here. Start chimera and use "Open" menu to open the downloaded script. Please note, you must have access to the internet to download the aligned structures.

Note: Flexibility is detected in one or more input structures where modified coordinates are used in the alignment. No other chains or ligands except the master chains in structure alignment are shown.
2RRM_Fail_hc.pdb
1fjeB-ali.pdb   
1cvjA-ali.pdb   
1ytyA-ali.pdb   
2adcA-ali.pdb   
3sdeA-ali.pdb   
3smzA-ali.pdb   
2kxfA-ali.pdb   
2yh0A-ali.pdb   
  |     |     |  3D viewer: Jmol. Try alternative viewer JSmol   |  Jmol tips and trouble shooting