POSA Home | FATCAT | Other Servers | Godzik Lab | School of Medicine, University of California, Reverside | Contact Us



The protein structure alignment is calculated on the following chains: 1fje:B; 1cvj:A; 1yty:A; 2adc:A; 3sde:A; 3smz:A; 2kxf:A; 2yh0:A;

After structure superposition, other chains that are added to the superimposed structures are: 1fje:A; 1cvj:M; 1yty:C; 2adc:B.

 /1cvjAM.pdb/ /A/ 11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   91   96   101  106  111  116  121  126  131  136  141  146  151  156  161  166  171  176  /M/ 1    6    
ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERA AAAAAAAAA
  /3sdeA.pdb/ /A/ 66   71   76   81   86   91   96   101  106  111  116  121  126  131  136  141  146  151  156  161  166  171  176  181  186  191  196  201  206  211  216  221  226  231  236  241  246  251  256  261  266  271  276  281  286  291  296  301  306  311  316  
DIKSFLKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFGFIRLESRTLAEIAKAELDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREAKEKLEAEMEAARHEHQLMLM
  /2kxfA.pdb/ /A/ 99   104  109  114  119  124  129  134  139  144  149  154  159  164  169  174  179  184  189  194  199  204  209  214  219  224  229  234  239  244  249  254  259  264  269  274  279  284  289  294  
GAMAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPAT
ColorPDBAligned Chain/SegmentsOther ChainsShow Ligands

common core regions

Download a UCSF Chimera script for publication ready visualization and multiple analysis tools here. Start chimera and use "Open" menu to open the downloaded script. Please note, you must have access to the internet to download the aligned structures.
2RRM_Fail_branch5.pdb
1cvjAM.pdb   
3sdeA.pdb   
2kxfA.pdb   
  |     |     |  3D viewer: Jmol. Try alternative viewer JSmol   |  Jmol tips and trouble shooting