POSA Home | FATCAT | Other Servers | Godzik Lab | School of Medicine, University of California, Reverside | Contact Us



The protein structure alignment is calculated on the following chains: 1fje:B; 1cvj:A; 1yty:A; 2adc:A; 3sde:A; 3smz:A; 2kxf:A; 2yh0:A;

After structure superposition, other chains that are added to the superimposed structures are: 1fje:A; 1cvj:M; 1yty:C; 2adc:B.

#segment    S1                                    S2                             S3              
1cvjA  { 88}GNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCD{1}NGSKGYGFVHFETQEAAERAIEKMNGML{1}NDRKVFVGRFKS{ 4}
2kxfA  {110}NRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARD{3}GKHKGYGFIEYEKAQSSQDAVSSMNLFD{1}GGQYLRVGKAVT{10}
3sdeA  { 90}AALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVD{2}GRATGKGFVEFAAKPPARKALERCGDGA{5}TPRPVIVEPMEQ{83}
ColorPDBAligned Chain/SegmentsOther ChainsShow Ligands

common core regions

Download a UCSF Chimera script for publication ready visualization and multiple analysis tools here. Start chimera and use "Open" menu to open the downloaded script. Please note, you must have access to the internet to download the aligned structures.
2RRM_Fail_branch5.pdb
1cvjAM.pdb   
3sdeA.pdb   
2kxfA.pdb   
  |     |     |  3D viewer: Jmol. Try alternative viewer JSmol   |  Jmol tips and trouble shooting