POSA Home | FATCAT | Other Servers | Godzik Lab | School of Medicine, University of California, Reverside | Contact Us



The protein structure alignment is calculated on the following chains: 1adj:D; 1h4q:B; 1qf6:A; 1ati:A;

 /1adjD.pdb/ /D/ 2    7    12   17   22   27   32   37   42   47   52   57   62   67   72   77   82   87   92   97   102  107  112  117  122  127  132  137  142  147  152  157  162  167  172  177  182  187  192  197  202  207  212  217  222  227  232  237  242  247  252  257  262  267  272  277  282  287  292  297  302  307  312  317  322  327  332  337  342  347  352  357  362  367  372  377  382  387  392  397  402  407  412  417  
TARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLEENPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG
 /1h4qB.pdb/ /B/ 5    10   15   20   25   30   35   40   45   50   55   60   65   70   75   89   94   99   104  109  114  119  124  129  134  139  144  149  154  159  164  169  174  179  184  189  194  199  204  209  214  219  224  229  234  239  244  249  254  259  264  269  274  279  284  289  294  299  304  309  314  319  324  329  334  339  344  349  354  359  364  369  374  379  384  389  394  399  404  409  414  419  424  429  434  439  444  449  454  459  464  469  474  
KGLTPQSQDFSEWYLEVIQKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTRPFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDESRERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKETLPLAALPEALPGKLDAFHEELYRRALAFREDHTRKVDTYEAFKEAVQEGFALAFHCGDKACERLIQEETTATTRCVPFEAEPEEGFCVRCGRPSAYGKRVVFAKAY
 /1qf6A.pdb/ /A/ 2    7    12   17   22   27   32   37   42   47   52   57   62   67   72   77   82   87   92   97   102  107  112  117  122  127  132  137  142  147  152  157  162  167  172  177  182  187  192  197  202  207  212  217  222  227  232  237  242  247  252  257  262  267  272  277  282  287  292  297  302  307  312  317  322  327  332  337  342  347  352  357  362  367  372  377  382  387  392  397  402  407  412  417  422  427  432  437  442  447  452  457  462  467  472  477  482  487  492  497  502  507  512  517  522  527  532  537  542  547  552  557  562  567  572  577  582  587  592  597  602  607  612  617  622  627  632  637  642  
PVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE
 /1atiA.pdb/ /A/ 1    6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   159  164  169  174  179  184  189  194  199  204  209  214  219  224  229  234  239  244  249  254  259  264  269  274  279  284  289  294  299  304  309  314  319  324  329  334  339  344  349  354  359  364  369  374  379  384  389  394  399  404  409  414  419  424  429  434  439  444  449  454  459  464  469  474  479  484  489  494  499  504  
AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW
ColorPDBAligned Chain/Segments

residues at approximate pivot positions
common core regions

Download a UCSF Chimera script for publication ready visualization and multiple analysis tools here. Start chimera and use "Open" menu to open the downloaded script. Please note, you must have access to the internet to download the aligned structures.

Note: Flexibility is detected in one or more input structures where modified coordinates are used in the alignment. No other chains or ligands except the master chains in structure alignment are shown.
tRNAsynthetase_hc.pdb
1adjD-ali.pdb   
1h4qB-ali.pdb   
1qf6A-ali.pdb   
1atiA-ali.pdb   
  |     |     |  3D viewer: Jmol. Try alternative viewer JSmol   |  Jmol tips and trouble shooting