POSA Home | FATCAT | Other Servers | Godzik Lab | School of Medicine, University of California, Reverside | Contact Us



The protein structure alignment is calculated on the following chains: d1ncxa_:A; d2sasa_:A; d1jfja_:A;

 /d1ncxa_A.pdb/ /A/ 1    6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   91   96   101  106  111  116  121  126  131  136  141  146  151  156  161  
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGEILRATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ
 /d2sasa_A.pdb/ /A/ 1    6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   91   96   101  106  111  116  121  126  131  136  141  146  151  156  161  166  171  176  181  
GLNDFQKQKIKFTFDFFLDMNHDGSIQDNDFEDMMTRYKEVNKGSLSDADYKSMQASLEDEWRDLKGRADINKDDVVSWEEYLAMWEKTIATCKSVADLPAWCQNRIPFLFKGMDVSGDGIVDLEEFQNYCKNFQLQCADVPAVYNVITDGGKVTFDLNRYKELYYRLLTSPAADAGNTLMGQKP
 /d1jfja_A.pdb/ /A/ 1    6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   91   96   101  106  111  116  121  126  131  
MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL
ColorPDBAligned Chain/SegmentsShow Ligands

common core regions

Download a UCSF Chimera script for publication ready visualization and multiple analysis tools here. Start chimera and use "Open" menu to open the downloaded script. Please note, you must have access to the internet to download the aligned structures.
Calmodulin.pdb
d1ncxa_A.pdb   
d2sasa_A.pdb   
d1jfja_A.pdb   
  |     |     |  3D viewer: Jmol. Try alternative viewer JSmol   |  Jmol tips and trouble shooting