POSA Home | FATCAT | Other Servers | Godzik Lab | School of Medicine, University of California, Reverside | Contact Us



The protein structure alignment is calculated on the following chains: 1a9n:B; 2err:A; 1yty:A; 2kg1:A; 1urn:A(11-16,40-46,55-60,76-86, in grey);

After structure superposition, other chains that are added to the superimposed structures are: 1a9n:Q; 2err:B; 1yty:C; 2kg1:B; 1urn:P.

 /1a9nBQ.pdb/ /B/ 6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   91   96   /Q/ 0    5    10   15   20   
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG CCUGGUAUUGCAGUACCUCCAGGU
 /2errAB.pdb/ /A/ 109  114  119  124  129  134  139  144  149  154  159  164  169  174  179  184  189  194  /B/ 197  202  
NTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVM UGCAUGU
 /1ytyAC.pdb/ /A/ 6    11   16   21   26   31   36   41   46   51   56   61   66   71   76   81   86   91   96   101  106  111  116  121  126  131  136  141  146  151  156  161  166  171  176  181  186  /C/ 1    6    
DNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYF UGCUGUUUU
 /2kg1AB.pdb/ /A/ 277  282  287  292  297  302  307  312  317  322  327  332  337  342  347  352  357  362  367  372  377  /B/ 1    6    
GDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMG AGGGAU
 /1urnAP.pdb/ /A/ 2    7    12   17   22   27   32   37   42   47   52   57   62   67   72   77   82   87   92   97   /P/ 1    6    11   17   
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM AAUCCAUUGCACUCGGAUUU
ColorPDBAligned Chain/SegmentsOther ChainsShow Ligands

common core regions

Download a UCSF Chimera script for publication ready visualization and multiple analysis tools here. Start chimera and use "Open" menu to open the downloaded script. Please note, you must have access to the internet to download the aligned structures.
RRM1urnSeg.pdb
1a9nBQ.pdb   
2errAB.pdb   
1ytyAC.pdb   
2kg1AB.pdb   
1urnAP.pdb   
  |     |     |  3D viewer: Jmol. Try alternative viewer JSmol   |  Jmol tips and trouble shooting